Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P52742-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
7-36 (30) VSTDPEQVTFEDVVVGFSQEEWGQLKPAQR PA
1
41-48 (8) DVMLDTFR PA
3
49-78 (30) LLVSVGHWLPKPNVISLLEQEAELWAVESR PA
3
79-92 (14) LPQGVYPDLETRPK PA
1
100-115 (16) QGISEEISNSVILVER PA
3
116-125 (10) FLWDGLWYCR PA
3
126-153 (28) GEDTEGHWEWSCESLESLAVPVAFTPVK PA
3
154-162 (9) TPVLEQWQR PA
3
163-184 (22) NGFGENISLNPDLPHQPMTPER PA
3
185-193 (9) QSPHTWGTR PA
3
197-206 (10) EKPDLNVLQK PA
3
222-234 (13) AFSHSSALIEHHR PA
3
235-249 (15) THTGERPYECHECLK PA
3
263-271 (9) IHTGEKPYK PA
242
278-290 (13) TFNQIAPLIQHQR PA
3
291-305 (15) THTGEKPYECSECGK PA
18
311-318 (8) SSFSQHER PA
3
319-333 (15) THTGEKPYECSECGK PA
18
337-346 (10) QSIHLTQHLR PA
3
347-361 (15) IHTGEKPYQCGECGK PA
8
362-371 (10) AFSHSSSLTK PA
2
375-389 (15) IHTGEKPYECHECGK PA
2
390-402 (13) AFTQITPLIQHQR PA
2
403-417 (15) THTGEKPYECGECGK PA
5
418-429 (12) AFSQSTLLTEHR PA
2
431-445 (15) IHTGEKPYGCNECGK PA
4
446-458 (13) TFSHSSSLSQHER PA
2
459-473 (15) THTGEKPYECSQCGK PA
6
477-486 (10) QSTHLTQHQR PA
2
487-501 (15) IHTGEKPYECNDCGK PA
4
502-511 (10) AFSHSSSLTK PA
2
515-529 (15) IHTGEKPYECNQCGR PA
2
530-542 (13) AFSQLAPLIQHQR PA
2
543-557 (15) IHTGEKPYECNQCGR PA
2
558-570 (13) AFSQSSLLIEHQR PA
2
575-585 (11) EKPYGCNECGK PA
2
586-598 (13) SFSHSSSLSQHER PA
2
599-613 (15) THTGEKPYECHDCGK PA
3
617-625 (9) QSTHLTQHR PA
2
627-637 (11) IHTGEKPYACR PA
3
642-651 (10) AFTHSSSLTK PA
3
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center