Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P52742-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
24-48 (25) EQVTFEDVVVGFSQEEWGQLKPAQR PA
1
53-60 (8) DVMLDTFR PA
3
61-90 (30) LLVSVGHWLPKPNVISLLEQEAELWAVESR PA
3
91-104 (14) LPQGVYPDLETRPK PA
1
112-127 (16) QGISEEISNSVILVER PA
3
128-137 (10) FLWDGLWYCR PA
3
138-165 (28) GEDTEGHWEWSCESLESLAVPVAFTPVK PA
3
166-174 (9) TPVLEQWQR PA
3
175-196 (22) NGFGENISLNPDLPHQPMTPER PA
3
197-205 (9) QSPHTWGTR PA
3
209-218 (10) EKPDLNVLQK PA
3
234-246 (13) AFSHSSALIEHHR PA
3
247-261 (15) THTGERPYECHECLK PA
3
275-283 (9) IHTGEKPYK PA
242
290-302 (13) TFNQIAPLIQHQR PA
3
303-317 (15) THTGEKPYECSECGK PA
18
323-330 (8) SSFSQHER PA
3
331-345 (15) THTGEKPYECSECGK PA
18
349-358 (10) QSIHLTQHLR PA
3
359-373 (15) IHTGEKPYQCGECGK PA
8
374-383 (10) AFTHSSSLTK PA
3
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center