Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P52742-3)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
7-36 (30) VSTDPEQVTFEDVVVGFSQEEWGQLKPAQR PA
1
41-48 (8) DVMLDTFR PA
3
49-78 (30) LLVSVGHWLPKPNVISLLEQEAELWAVESR PA
3
79-88 (10) LPQGVYPEIK PA
1
89-104 (16) GHFQFLLLSDLETRPK PA
1
112-127 (16) QGISEEISNSVILVER PA
3
128-137 (10) FLWDGLWYCR PA
3
138-165 (28) GEDTEGHWEWSCESLESLAVPVAFTPVK PA
3
166-174 (9) TPVLEQWQR PA
3
175-196 (22) NGFGENISLNPDLPHQPMTPER PA
3
197-205 (9) QSPHTWGTR PA
3
209-218 (10) EKPDLNVLQK PA
3
234-246 (13) AFSHSSALIEHHR PA
3
247-261 (15) THTGERPYECHECLK PA
3
275-283 (9) IHTGEKPYK PA
242
290-302 (13) TFNQIAPLIQHQR PA
3
303-317 (15) THTGEKPYECSECGK PA
18
323-330 (8) SSFSQHER PA
3
331-345 (15) THTGEKPYECSECGK PA
18
349-358 (10) QSIHLTQHLR PA
3
359-373 (15) IHTGEKPYQCGECGK PA
8
374-383 (10) AFSHSSSLTK PA
2
387-401 (15) IHTGEKPYECHECGK PA
2
402-414 (13) AFTQITPLIQHQR PA
2
415-429 (15) THTGEKPYECGECGK PA
5
430-441 (12) AFSQSTLLTEHR PA
2
443-457 (15) IHTGEKPYGCNECGK PA
4
458-470 (13) TFSHSSSLSQHER PA
2
471-485 (15) THTGEKPYECSQCGK PA
6
489-498 (10) QSTHLTQHQR PA
2
499-513 (15) IHTGEKPYECNDCGK PA
4
514-523 (10) AFSHSSSLTK PA
2
527-541 (15) IHTGEKPYECNQCGR PA
2
542-554 (13) AFSQLAPLIQHQR PA
2
555-569 (15) IHTGEKPYECNQCGR PA
2
570-582 (13) AFSQSSLLIEHQR PA
2
587-597 (11) EKPYGCNECGK PA
2
598-610 (13) SFSHSSSLSQHER PA
2
611-625 (15) THTGEKPYECHDCGK PA
3
629-637 (9) QSTHLTQHR PA
2
639-649 (11) IHTGEKPYACR PA
3
654-663 (10) AFTHSSSLTK PA
3
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center