Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P52742-4)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
24-48 (25) EQVTFEDVVVGFSQEEWGQLKPAQR PA
1
53-60 (8) DVMLDTFR PA
3
61-90 (30) LLVSVGHWLPKPNVISLLEQEAELWAVESR PA
3
91-100 (10) LPQGVYPEIK PA
1
101-116 (16) GHFQFLLLSDLETRPK PA
1
124-139 (16) QGISEEISNSVILVER PA
3
140-149 (10) FLWDGLWYCR PA
3
150-177 (28) GEDTEGHWEWSCESLESLAVPVAFTPVK PA
3
178-186 (9) TPVLEQWQR PA
3
187-208 (22) NGFGENISLNPDLPHQPMTPER PA
3
209-217 (9) QSPHTWGTR PA
3
221-230 (10) EKPDLNVLQK PA
3
246-258 (13) AFSHSSALIEHHR PA
3
259-273 (15) THTGERPYECHECLK PA
3
287-295 (9) IHTGEKPYK PA
242
302-314 (13) TFNQIAPLIQHQR PA
3
315-329 (15) THTGEKPYECSECGK PA
18
335-342 (8) SSFSQHER PA
3
343-357 (15) THTGEKPYECSECGK PA
18
361-370 (10) QSIHLTQHLR PA
3
371-385 (15) IHTGEKPYQCGECGK PA
8
386-395 (10) AFSHSSSLTK PA
2
399-413 (15) IHTGEKPYECHECGK PA
2
414-426 (13) AFTQITPLIQHQR PA
2
427-441 (15) THTGEKPYECGECGK PA
5
442-453 (12) AFSQSTLLTEHR PA
2
455-469 (15) IHTGEKPYGCNECGK PA
4
470-482 (13) TFSHSSSLSQHER PA
2
483-497 (15) THTGEKPYECSQCGK PA
6
501-510 (10) QSTHLTQHQR PA
2
511-525 (15) IHTGEKPYECNDCGK PA
4
526-535 (10) AFSHSSSLTK PA
2
539-553 (15) IHTGEKPYECNQCGR PA
2
554-566 (13) AFSQLAPLIQHQR PA
2
567-581 (15) IHTGEKPYECNQCGR PA
2
582-594 (13) AFSQSSLLIEHQR PA
2
599-609 (11) EKPYGCNECGK PA
2
610-622 (13) SFSHSSSLSQHER PA
2
623-637 (15) THTGEKPYECHDCGK PA
3
641-649 (9) QSTHLTQHR PA
2
651-661 (11) IHTGEKPYACR PA
3
666-675 (10) AFTHSSSLTK PA
3
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center