Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P54756-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
13-36 (24) RPPSGGGDTPITPASLAGCYSAPR PA
1
38-51 (14) APLWTCLLLCAALR PA
1
52-67 (16) TLLASPSNEVNLLDSR PA
1
68-80 (13) TVMGDLGWIAFPK PA
1
81-103 (23) NGWEEIGEVDENYAPIHTYQVCK PA
2
104-125 (22) VMEQNQNNWLLTSWISNEGASR PA
2
136-148 (13) DCNSLPGGLGTCK PA
2
149-164 (16) ETFNMYYFESDDQNGR PA
2
174-191 (18) IDTIAADESFTELDLGDR PA
2
209-227 (19) GFYLAFQDVGACIALVSVR PA
4
239-273 (35) HLAVFPDTITGADSSQLLEVSGSCVNHSVTDEPPK PA
2
274-288 (15) MHCSAEGEWLVPIGK PA
7
299-311 (13) NGTCQVCRPGFFK PA
2
312-321 (10) ASPHIQSCGK PA
2
322-340 (19) CPPHSYTHEEASTSCVCEK PA
2
346-362 (17) ESDPPTMACTRPPSAPR PA
2
363-386 (24) NAISNVNETSVFLEWIPPADTGGR PA
2
388-396 (9) DVSYYIACK PA
2
398-413 (16) CNSHAGVCEECGGHVR PA
2
423-455 (33) NTSVMMVDLLAHTNYTFEIEAVNGVSDLSPGAR PA
2
456-476 (21) QYVSVNVTTNQAAPSPVTNVK PA
2
483-505 (23) NSISLSWQEPDRPNGIILEYEIK PA
2
510-519 (10) DQETSYTIIK PA
2
522-541 (20) ETTITAEGLKPASVYVFQIR PA
2
544-553 (10) TAAGYGVFSR PA
2
555-605 (51) FEFETTPVFAASSDQSQIPVIAVSVTVGVILLAVVIGVLLSGSCCECGCGR PA
0
606-620 (15) ASSLCAVAHPSLIWR PA
1
635-643 (9) MHFHNGHIK PA
2
649-668 (20) TYIDPHTYEDPNQAVHEFAK PA
2
669-679 (11) EIEASCITIER PA
2
680-693 (14) VIGAGEFGEVCSGR PA
8
720-745 (26) DFLGEASIMGQFDHPNIIHLEGVVTK PA
2
746-766 (21) SKPVMIVTEYMENGSLDTFLK PA
2
768-782 (15) NDGQFTVIQLVGMLR PA
2
790-799 (10) YLSDMGYVHR PA
6
805-815 (11) NILINSNLVCK PA
3
816-823 (8) VSDFGLSR PA
20
824-836 (13) VLEDDPEAAYTTR PA
5
844-853 (10) WTAPEAIAFR PA
4
855-889 (35) FTSASDVWSYGIVMWEVVSYGERPYWEMTNQDVIK PA
2
897-917 (21) LPSPMDCPAALYQLMLDCWQK PA
2
925-934 (10) FDEIVNMLDK PA
2
944-951 (8) TLVNASCR PA
2
952-968 (17) VSNLLAEHSPLGSGAYR PA
2
969-978 (10) SVGEWLEAIK PA
2
982-1006 (25) YTEIFMENGYSSMDAVAQVTLEDLR PA
2
1008-1017 (10) LGVTLVGHQK PA
2
1019-1027 (9) IMNSLQEMK PA
2
1028-1037 (10) VQLVNGMVPL PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center