Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P54756-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
13-36 (24) RPPSGGGDTPITPASLAGCYSAPR PA
1
38-51 (14) APLWTCLLLCAALR PA
1
52-67 (16) TLLASPSNEVNLLDSR PA
1
68-80 (13) TVMGDLGWIAFPK PA
1
81-103 (23) NGWEEIGEVDENYAPIHTYQVCK PA
2
104-125 (22) VMEQNQNNWLLTSWISNEGASR PA
2
136-148 (13) DCNSLPGGLGTCK PA
2
149-164 (16) ETFNMYYFESDDQNGR PA
2
174-191 (18) IDTIAADESFTELDLGDR PA
2
209-227 (19) GFYLAFQDVGACIALVSVR PA
4
239-273 (35) HLAVFPDTITGADSSQLLEVSGSCVNHSVTDEPPK PA
2
274-288 (15) MHCSAEGEWLVPIGK PA
7
299-311 (13) NGTCQVCRPGFFK PA
2
312-321 (10) ASPHIQSCGK PA
2
322-340 (19) CPPHSYTHEEASTSCVCEK PA
2
346-362 (17) ESDPPTMACTRPPSAPR PA
2
363-386 (24) NAISNVNETSVFLEWIPPADTGGR PA
2
388-396 (9) DVSYYIACK PA
2
398-413 (16) CNSHAGVCEECGGHVR PA
2
423-455 (33) NTSVMMVDLLAHTNYTFEIEAVNGVSDLSPGAR PA
2
456-476 (21) QYVSVNVTTNQAAPSPVTNVK PA
2
483-505 (23) NSISLSWQEPDRPNGIILEYEIK PA
2
510-519 (10) DQETSYTIIK PA
2
522-541 (20) ETTITAEGLKPASVYVFQIR PA
2
544-553 (10) TAAGYGVFSR PA
2
555-597 (43) FEFETTPVFAASSDQSQIPVIAVSVTVGVILLAVVIGVLLSGR PA
0
613-621 (9) MHFHNGHIK PA
2
627-646 (20) TYIDPHTYEDPNQAVHEFAK PA
2
647-657 (11) EIEASCITIER PA
2
658-671 (14) VIGAGEFGEVCSGR PA
8
698-723 (26) DFLGEASIMGQFDHPNIIHLEGVVTK PA
2
724-744 (21) SKPVMIVTEYMENGSLDTFLK PA
2
746-760 (15) NDGQFTVIQLVGMLR PA
2
768-777 (10) YLSDMGYVHR PA
6
783-793 (11) NILINSNLVCK PA
3
794-801 (8) VSDFGLSR PA
20
802-814 (13) VLEDDPEAAYTTR PA
5
822-831 (10) WTAPEAIAFR PA
4
833-867 (35) FTSASDVWSYGIVMWEVVSYGERPYWEMTNQDVIK PA
2
875-895 (21) LPSPMDCPAALYQLMLDCWQK PA
2
903-912 (10) FDEIVNMLDK PA
2
922-929 (8) TLVNASCR PA
2
930-946 (17) VSNLLAEHSPLGSGAYR PA
2
947-956 (10) SVGEWLEAIK PA
2
960-984 (25) YTEIFMENGYSSMDAVAQVTLEDLR PA
2
986-995 (10) LGVTLVGHQK PA
2
997-1005 (9) IMNSLQEMK PA
2
1006-1015 (10) VQLVNGMVPL PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center