Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P54756-3)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-11 (11) MGDLGWIAFPK PA
0
12-34 (23) NGWEEIGEVDENYAPIHTYQVCK PA
2
35-56 (22) VMEQNQNNWLLTSWISNEGASR PA
2
67-79 (13) DCNSLPGGLGTCK PA
2
80-95 (16) ETFNMYYFESDDQNGR PA
2
105-122 (18) IDTIAADESFTELDLGDR PA
2
140-158 (19) GFYLAFQDVGACIALVSVR PA
4
170-204 (35) HLAVFPDTITGADSSQLLEVSGSCVNHSVTDEPPK PA
2
205-219 (15) MHCSAEGEWLVPIGK PA
7
230-242 (13) NGTCQVCRPGFFK PA
2
243-252 (10) ASPHIQSCGK PA
2
253-271 (19) CPPHSYTHEEASTSCVCEK PA
2
277-293 (17) ESDPPTMACTRPPSAPR PA
2
294-317 (24) NAISNVNETSVFLEWIPPADTGGR PA
2
319-327 (9) DVSYYIACK PA
2
329-344 (16) CNSHAGVCEECGGHVR PA
2
354-386 (33) NTSVMMVDLLAHTNYTFEIEAVNGVSDLSPGAR PA
2
387-407 (21) QYVSVNVTTNQAAPSPVTNVK PA
2
414-436 (23) NSISLSWQEPDRPNGIILEYEIK PA
2
441-450 (10) DQETSYTIIK PA
2
453-472 (20) ETTITAEGLKPASVYVFQIR PA
2
475-484 (10) TAAGYGVFSR PA
2
486-537 (52) FEFETTPVSVAASSDQSQIPVIAVSVTVGVILLAVVIGVLLSGSCCECGCGR PA
0
538-552 (15) ASSLCAVAHPSLIWR PA
1
567-575 (9) MHFHNGHIK PA
2
581-600 (20) TYIDPHTYEDPNQAVHEFAK PA
2
601-611 (11) EIEASCITIER PA
2
612-625 (14) VIGAGEFGEVCSGR PA
8
652-677 (26) DFLGEASIMGQFDHPNIIHLEGVVTK PA
2
678-698 (21) SKPVMIVTEYMENGSLDTFLK PA
2
700-714 (15) NDGQFTVIQLVGMLR PA
2
722-731 (10) YLSDMGYVHR PA
6
737-747 (11) NILINSNLVCK PA
3
748-755 (8) VSDFGLSR PA
20
756-768 (13) VLEDDPEAAYTTR PA
5
776-785 (10) WTAPEAIAFR PA
4
787-821 (35) FTSASDVWSYGIVMWEVVSYGERPYWEMTNQDVIK PA
2
829-849 (21) LPSPMDCPAALYQLMLDCWQK PA
2
857-866 (10) FDEIVNMLDK PA
2
876-883 (8) TLVNASCR PA
2
884-900 (17) VSNLLAEHSPLGSGAYR PA
2
901-910 (10) SVGEWLEAIK PA
2
914-938 (25) YTEIFMENGYSSMDAVAQVTLEDLR PA
2
940-949 (10) LGVTLVGHQK PA
2
951-959 (9) IMNSLQEMK PA
2
960-969 (10) VQLVNGMVPL PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center