Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P57075-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-11 (11) MAAGETQLYAK PA
2
20-40 (21) SSPSLLEPLLAMGFPVHTALK PA
2
49-87 (39) TAEEALAWLHDHCNDPSLDDPIPQEYALFLCPTGPLLEK PA
2
104-123 (20) AHEVFPHVTLCDFFTCEDQK PA
2
124-132 (9) VECLYEALK PA
2
138-170 (33) LLGSFPTAVPLALHSSISYLGFFVSGSPADVIR PA
2
171-190 (20) EFAMTFATEASLLAGTSVSR PA
0
191-205 (15) FWIFSQVPGHGPNLR PA
0
212-222 (11) ASFVSHYILQK PA
0
223-231 (9) YCSVKPCTK PA
0
232-240 (9) QLHLTLAHK PA
2
255-271 (17) AIPLGHSCQWTAALYSR PA
2
275-282 (8) FVHYQTLR PA
2
283-324 (42) ALFQYKPQNVDELTLSPGDYIFVDPTQQDEASEGWVIGISQR PA
2
329-338 (10) GFLPENYTDR PA
2
339-347 (9) ASESDTWVK PA
2
350-362 (13) MYTFSLATDLNSR PA
2
371-381 (11) CSGEFLPQTAR PA
2
382-395 (14) SLSSLQALQATVAR PA
2
414-425 (12) AWLQQCSTPDGK PA
2
426-439 (14) YYRPDLNFPCSLPR PA
2
446-462 (17) DFENDPPLSSCGIFQSR PA
2
463-474 (12) IAGDALLDSGIR PA
2
475-485 (11) ISSVFASPALR PA
2
507-516 (10) VEPGIFEWTK PA
2
522-533 (12) TTPTLMSLEELK PA
2
534-564 (31) EANFNIDTDYRPAFPLSALMPAESYQEYMDR PA
1
565-605 (41) CTASMVQIVNTCPQDTGVILIVSHGSTLDSCTRPLLGLPPR PA
1
606-615 (10) ECGDFAQLVR PA
1
617-629 (13) IPSLGMCFCEENK PA
1
634-642 (9) WELVNPPVK PA
1
643-655 (13) TLTHGANAAFNWR PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center