Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P57075-3)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-11 (11) MAAGETQLYAK PA
2
20-40 (21) SSPSLLEPLLAMGFPVHTALK PA
2
49-87 (39) TAEEALAWLHDHCNDPSLDDPIPQEYALFLCPTGPLLEK PA
2
104-123 (20) AHEVFPHVTLCDFFTCEDQK PA
2
124-132 (9) VECLYEALK PA
2
138-170 (33) LLGSFPTAVPLALHSSISYLGFFVSGSPADVIR PA
2
171-193 (23) EFAMTFATEASLLADCSVKPCTK PA
1
194-202 (9) QLHLTLAHK PA
2
217-233 (17) AIPLGHSCQWTAALYSR PA
2
237-244 (8) FVHYQTLR PA
2
245-286 (42) ALFQYKPQNVDELTLSPGDYIFVDPTQQDEASEGWVIGISQR PA
2
291-300 (10) GFLPENYTDR PA
2
301-309 (9) ASESDTWVK PA
2
312-324 (13) MYTFSLATDLNSR PA
2
333-343 (11) CSGEFLPQTAR PA
2
344-357 (14) SLSSLQALQATVAR PA
2
376-387 (12) AWLQQCSTPDGK PA
2
388-401 (14) YYRPDLNFPCSLPR PA
2
408-424 (17) DFENDPPLSSCGIFQSR PA
2
425-436 (12) IAGDALLDSGIR PA
2
437-447 (11) ISSVFASPALR PA
2
469-478 (10) VEPGIFEWTK PA
2
484-495 (12) TTPTLMSLEELK PA
2
496-506 (11) EANFNIDTDYR PA
0
507-516 (10) SLPWACASVK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center