Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P59533-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
16-46 (31) STFLFISVLEFAVGFLTNAFVFLVNFWDVVK PA
0
48-64 (17) QALSNSDCVLLCLSISR PA
0
65-83 (19) LFLHGLLFLSAIQLTHFQK PA
0
84-120 (37) LSEPLNHSYQAIIMLWMIANQANLWLAACLSLLYCSK PA
0
124-138 (15) FSHTFLICLASWVSR PA
0
140-181 (42) ISQMLLGIILCSCICTVLCVWCFFSRPHFTVTTVLFMNNNTR PA
0
188-222 (35) DLNLFYSFLFCYLWSVPPFLLFLVSSGMLTVSLGR PA
0
236-244 (9) DPSLEAHIK PA
0
248-274 (27) SLVSFFCFFVISSCAAFISVPLLILWR PA
0
277-303 (27) IGVMVCVGIMAACPSGHAAILISGNAK PA
0
307-320 (14) AVMTILLWAQSSLK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center