Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P59535-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-11 (11) MATVNTDATDK PA
0
18-49 (32) VTFTLVVSGIECITGILGSGFITAIYGAEWAR PA
0
59-67 (9) IMLMLSFSR PA
0
68-85 (18) LLLQIWMMLENIFSLLFR PA
0
86-98 (13) IVYNQNSVYILFK PA
0
99-116 (18) VITVFLNHSNLWFAAWLK PA
0
123-135 (13) IANFNHPLFFLMK PA
0
138-147 (10) IIVLMPWLLR PA
0
148-162 (15) LSVLVSLSFSFPLSR PA
0
163-183 (21) DVFNVYVNSSIPIPSSNSTEK PA
0
185-221 (37) YFSETNMVNLVFFYNMGIFVPLIMFILAATLLILSLK PA
0
223-235 (13) HTLHMGSNATGSR PA
0
248-282 (35) ATSYFLILYIFNAIALFLSTSNIFDTYSSWNILCK PA
0
283-304 (22) IIMAAYPAGHSVQLILGNPGLR PA
0
310-319 (10) FQHQVPLYLK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center