Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P59797-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
7-14 (8) TPAPSSAR PA
0
45-80 (36) TLTPVLTPSPAGTSPLVLTPAPAQIPTLVPTPALAR PA
0
84-104 (21) LVPPPAPAWIPTPVPTPVPVR PA
0
105-114 (10) NPTPVPTPAR PA
0
122-135 (14) VPAPAPAQLLAGIR PA
0
136-176 (41) AALPVLDSYLAPALPLDPPPEPAPELPLLPEEDPEPAPSLK PA
0
177-195 (19) LIPSVSSEAGPAPGPLPTR PA
0
196-212 (17) TPLAANSPGPTLDFTFR PA
0
213-261 (49) ADPSAIGLADPPIPSPVPSPILGTIPSAISLQNCTETFPSSSENFALDK PA
0
267-278 (12) VTYCGLUSYSLR PA
0
285-300 (16) SLEQQFPNHLLFEEDR PA
0
301-315 (15) AAQATGEFEVFVNGR PA
0
323-331 (9) GDGFVNESR PA
0
335-344 (10) IVSVIDEEIK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center