Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P59826-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-33 (33) MQPVMLALWSLLLLWGLATPCQELLETVGTLAR PA
0
42-65 (24) AIQNSLVGEPILQNVLGSVTAVNR PA
0
66-96 (31) GLLGSGGLLGGGGLLGHGGVFGVVEELSGLK PA
0
97-104 (8) IEELTLPK PA
0
109-122 (14) LLPGFGVQLSLHTK PA
0
123-146 (24) VGMHCSGPLGGLLQLAAEVNVTSR PA
0
147-154 (8) VALAVSSR PA
0
155-162 (8) GTPILILK PA
0
164-192 (29) CSTLLGHISLFSGLLPTPLFGVVEQMLFK PA
0
193-252 (60) VLPGLLCPVVDSVLGVVNELLGAVLGLVSLGALGSVEFSLATLPLISNQYIELDINPIVK PA
0
253-263 (11) SVAGDIIDFPK PA
0
275-330 (56) DHTSQVMVPLYLFNTTFGLLQTNGALDMDITPELVPSDVPLTTTDLAALLPEALGK PA
0
331-342 (12) LPLHQQLLLFLR PA
0
345-354 (10) EAPTVTLHNK PA
0
356-372 (17) ALVSLPANIHVLFYVPK PA
0
373-388 (16) GTPESLFELNSVMTVR PA
0
389-397 (9) AQLAPSATK PA
0
398-406 (9) LHISLSLER PA
0
411-423 (13) VASSFTHAFDGSR PA
0
424-439 (16) LEEWLSHVVGAVYAPK PA
0
440-452 (13) LNVALDVGIPLPK PA
0
453-476 (24) VLNINFSNSVLEIVENAVVLTVAS PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center