Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P59827-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-27 (27) MWMAWCVAALSVVAVCGTSHETNTVLR PA
0
31-52 (22) DVLSNAISGMLQQSDALHSALR PA
0
53-69 (17) EVPLGVGDIPYNDFHVR PA
1
70-79 (10) GPPPVYTNGK PA
1
81-102 (22) LDGIYQYGHIETNDNTAQLGGK PA
1
105-116 (12) YGEILESEGSIR PA
1
125-134 (10) SAENAYGGHR PA
1
151-228 (78) ELQPGEIPPGVATGAVGPGGLLGTGGMLAADGILAGQGGLLGGGGLLGDGGLLGGGGVLGVLGEGGILSTVQGITGLR PA
1
229-236 (8) IVELTLPR PA
1
241-254 (14) LLPGVGVYLSLYTR PA
1
261-277 (17) SLIGFLDIAVEVNITAK PA
1
295-303 (9) CDTLLGGIK PA
1
309-321 (13) GLLPNLVDNLVNR PA
1
322-417 (96) VLADVLPDLLCPIVDVVLGLVNDQLGLVDSLIPLGILGSVQYTFSSLPLVTGEFLELDLNTLVGEAGGGLIDYPLGWPAV
SPKPMPELPPMGDNTK PA
1
418-436 (19) SQLAMSANFLGSVLTLLQK PA
1
437-466 (30) QHALDLDITNGMFEELPPLTTATLGALIPK PA
1
467-480 (14) VFQQYPESCPLIIR PA
1
481-493 (13) IQVLNPPSVMLQK PA
1
500-512 (13) VLATAEVMVSQPK PA
1
513-537 (25) DLETTICLIDVDTEFLASFSTEGDK PA
1
553-570 (18) TSNVGNFDIGLMEVLVEK PA
1
571-592 (22) IFDLAFMPAMNAVLGSGVPLPK PA
1
593-614 (22) ILNIDFSNADIDVLEDLLVLSA PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center