Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P59827-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-13 (13) MLQQSDALHSALR PA
0
14-30 (17) EVPLGVGDIPYNDFHVR PA
1
31-40 (10) GPPPVYTNGK PA
1
42-63 (22) LDGIYQYGHIETNDNTAQLGGK PA
1
66-77 (12) YGEILESEGSIR PA
1
86-95 (10) SAENAYGGHR PA
1
112-189 (78) ELQPGEIPPGVATGAVGPGGLLGTGGMLAADGILAGQGGLLGGGGLLGDGGLLGGGGVLGVLGEGGILSTVQGITGLR PA
1
190-197 (8) IVELTLPR PA
1
202-215 (14) LLPGVGVYLSLYTR PA
1
222-238 (17) SLIGFLDIAVEVNITAK PA
1
256-264 (9) CDTLLGGIK PA
1
270-282 (13) GLLPNLVDNLVNR PA
1
283-378 (96) VLADVLPDLLCPIVDVVLGLVNDQLGLVDSLIPLGILGSVQYTFSSLPLVTGEFLELDLNTLVGEAGGGLIDYPLGWPAV
SPKPMPELPPMGDNTK PA
1
379-397 (19) SQLAMSANFLGSVLTLLQK PA
1
398-427 (30) QHALDLDITNGMFEELPPLTTATLGALIPK PA
1
428-441 (14) VFQQYPESCPLIIR PA
1
442-454 (13) IQVLNPPSVMLQK PA
1
461-473 (13) VLATAEVMVSQPK PA
1
474-498 (25) DLETTICLIDVDTEFLASFSTEGDK PA
1
514-531 (18) TSNVGNFDIGLMEVLVEK PA
1
532-553 (22) IFDLAFMPAMNAVLGSGVPLPK PA
1
554-575 (22) ILNIDFSNADIDVLEDLLVLSA PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center