Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P59998-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-13 (13) MTATLRPYLSAVR PA
1
14-32 (19) ATLQAALCLENFSSQVVER PA
2
33-41 (9) HNKPEVEVR PA
2
45-55 (11) ELLLQPVTISR PA
2
61-71 (11) VLIEGSINSVR PA
2
98-105 (8) AENFFILR PA
3
114-125 (12) IFTIQGCYPVIR PA
1
142-151 (10) SGPTLLPPQK PA
1
152-188 (37) DLDSSAMGDSDTTEDEDEDEDEEFQPSQLFDFDDLLK PA
1
189-207 (19) FDDLDGTHALMVGLCLNLR PA
1
208-223 (16) NLPWFDEVDANSFFPR PA
1
224-233 (10) CYCLGAEDDK PA
1
248-278 (31) NPVLVSPEFVDEALCACEEYLSNLAHMDIDK PA
1
279-297 (19) DLEAPLYLTPEGWSLFLQR PA
3
298-309 (12) YYQVVHEGAELR PA
3
310-317 (8) HLDTQVQR PA
3
318-338 (21) CEDILQQLQAVVPQIDMEGDR PA
3
339-348 (10) NIWIVKPGAK PA
4
353-365 (13) GIMCMDHLEEMLK PA
4
366-375 (10) LVNGNPVVMK PA
4
384-395 (12) YIERPLLIFGTK PA
4
400-416 (17) QWFLVTDWNPLTVWFYR PA
4
422-430 (9) FSTQPFSLK PA
4
431-445 (15) NLDNSVHLCNNSIQK PA
4
446-453 (8) HLENSCHR PA
4
454-467 (14) HPLLPPDNMWSSQR PA
4
468-490 (23) FQAHLQEMGAPNAWSTIIVPGMK PA
4
491-507 (17) DAVIHALQTSQDTVQCR PA
4
509-546 (38) ASFELYGADFVFGEDFQPWLIEINASPTMAPSTAVTAR PA
4
547-557 (11) LCAGVQADTLR PA
4
567-578 (12) NCDTGAFELIYK PA
4
579-602 (24) QPVTTSPASTPRPSCLLPMYSDTR PA
2
605-625 (21) SSDDSTASWWALRPCRPQARP PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center