Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P60484-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
16-41 (26) YQEDGFDLDLTYIYPNIIAMGFPAER PA
2
48-55 (8) NNIDDVVR PA
1
67-74 (8) IYNLCAER PA
1
85-125 (41) VAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAAIHCK PA
2
131-142 (12) TGVMICAYLLHR PA
2
148-159 (12) AQEALDFYGEVR PA
2
165-172 (8) GVTIPSQR PA
1
174-183 (10) YVYYYSYLLK PA
1
184-197 (14) NHLDYRPVALLFHK PA
1
198-221 (24) MMFETIPMFSGGTCNPQFVVCQLK PA
1
224-233 (10) IYSSNSGPTR PA
1
238-254 (17) FMYFEFPQPLPVCGDIK PA
1
270-289 (20) MFHFWVNTFFIPGPEETSEK PA
1
290-308 (19) VENGSLCDQEIDSICSIER PA
1
314-322 (9) EYLVLTLTK PA
1
350-378 (29) TVEEPSNPEASSSTSVTPDVSDNEPDHYR PA
1
379-402 (24) YSDTTDSDPENEPFDEDQHTQITK PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center