Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P60484-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
4-20 (17) GGEAAAAAAAAAAAPGR PA
0
21-30 (10) GSESPVTISR PA
0
31-47 (17) AGNAGELVSPLLLPPTR PA
0
53-74 (22) HIQGPGPVLNLPSAAAAPPVAR PA
0
75-84 (10) APEAAGGGSR PA
0
85-107 (23) SEDYSSSPHSAAAAARPLAAEEK PA
0
108-118 (11) QAQSLQPSSSR PA
0
120-135 (16) SSHYPAAVQSQAAAER PA
0
155-170 (16) HQQLLPSLSSFFFSHR PA
0
171-179 (9) LPDMTAIIK PA
0
189-214 (26) YQEDGFDLDLTYIYPNIIAMGFPAER PA
2
221-228 (8) NNIDDVVR PA
1
240-247 (8) IYNLCAER PA
1
258-298 (41) VAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAAIHCK PA
2
304-315 (12) TGVMICAYLLHR PA
2
321-332 (12) AQEALDFYGEVR PA
2
338-345 (8) GVTIPSQR PA
1
347-356 (10) YVYYYSYLLK PA
1
357-370 (14) NHLDYRPVALLFHK PA
1
371-394 (24) MMFETIPMFSGGTCNPQFVVCQLK PA
1
397-406 (10) IYSSNSGPTR PA
1
411-427 (17) FMYFEFPQPLPVCGDIK PA
1
443-462 (20) MFHFWVNTFFIPGPEETSEK PA
1
463-481 (19) VENGSLCDQEIDSICSIER PA
1
487-495 (9) EYLVLTLTK PA
1
523-551 (29) TVEEPSNPEASSSTSVTPDVSDNEPDHYR PA
1
552-575 (24) YSDTTDSDPENEPFDEDQHTQITK PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center