Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P60484-3)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
16-41 (26) YQEDGFDLDLTYIYPNIIAMGFPAER PA
2
48-59 (12) NNIDDVVSCAER PA
0
70-110 (41) VAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAAIHCK PA
2
116-127 (12) TGVMICAYLLHR PA
2
133-144 (12) AQEALDFYGEVR PA
2
150-159 (10) ADPTGGIPDK PA
0
160-175 (16) GIIVIGDGSSMDVIAP PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center