Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P60509-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-9 (9) MDPLHTIEK PA
0
26-35 (10) MGDGTPGRPK PA
0
36-43 (8) ISVQQMTR PA
0
44-106 (63) FSLIIFFLSAPFVVNASTSNVFLQWAHSYADGLQQGDPCWVCGSLPVTNTMELPWWVSPLQGK PA
0
107-119 (13) DWVFFQSFIGDLK PA
0
120-131 (12) QWTGAQMTGVTR PA
0
133-141 (9) NISEWPINK PA
0
142-158 (17) TLNEPGHDKPFSVNETR PA
0
161-172 (12) VIAFAIPLLDTK PA
0
173-186 (14) VFVQTSRPQNTQYR PA
0
187-203 (17) NGFLQIWDGFIWLTATK PA
0
204-217 (14) GHLSQIAPLCWEQR PA
0
218-229 (12) NHSLDNWPNTTR PA
0
230-240 (11) VMGWIPPGQCR PA
0
241-248 (8) HTILLQQR PA
0
249-299 (51) DLFATDWSQQPGLNWYAPNGTQWLCSPNLWPWLPSGWLGCCTLGIPWAQGR PA
0
303-319 (17) TMEVYPYLPHVVNQGTR PA
0
325-354 (30) NDHLPTIFMPSVGLGTVIQHIEALANFTQR PA
0
355-381 (27) ALNDSLQSISLMNAEVYYMHEDILQNR PA
0
382-399 (18) MALDILTAAEGGTCALIK PA
0
400-411 (12) TECCVYIPNNSR PA
0
412-422 (11) NISLALEDTCR PA
0
423-451 (29) QIQVISSSALSLHDWIASQFSGRPSWWQK PA
0
452-474 (23) ILIVLATLWSVGIALCCGLYFCR PA
0
475-506 (32) MFSQHIPQTHSIIFQQELPLSPPSQEHYQSQR PA
0
507-514 (8) DIFHSNAP PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center