Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P61421-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-21 (21) MSFFPELYFNVDNGYLEGLVR PA
0
25-46 (22) AGVLSQADYLNLVQCETLEDLK PA
0
47-73 (27) LHLQSTDYGNFLANEASPLTVSVIDDR PA
0
87-120 (34) NHAYEPLASFLDFITYSYMIDNVILLITGTLHQR PA
0
121-128 (8) SIAELVPK PA
0
129-182 (54) CHPLGSFEQMEAVNIAQTPAELYNAILVDTPLAAFFQDCISEQDLDEMNIEIIR PA
0
188-195 (8) AYLESFYK PA
0
196-218 (23) FCTLLGGTTADAMCPILEFEADR PA
0
220-234 (15) AFIITINSFGTELSK PA
0
247-257 (11) LYPEGLAQLAR PA
0
258-265 (8) ADDYEQVK PA
0
266-275 (10) NVADYYPEYK PA
0
276-288 (13) LLFEGAGSNPGDK PA
0
304-320 (17) LAFLNQFHFGVFYAFVK PA
0
328-339 (12) NIVWIAECIAQR PA
0
344-351 (8) IDNYIPIF PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center