Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P63129-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-13 (13) WASQVSENRPVCK PA
11
20-41 (22) QFEGLVDTGADVSIIALNQWPK PA
10
48-94 (47) AVTGLVGIGTASEVYQSTEILHCLGPDNQESTVQPMITSIPLNLWGR PA
4
95-117 (23) DLLQQWGAEITMPAPLYSPTSQK PA
7
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center