Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P63130-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
12-20 (9) YASYLSFIK PA
10
38-58 (21) LFQIIEQFCPWFPEQGTLDLK PA
9
74-89 (16) GNIIPLTVWNDWAIIK PA
10
90-99 (10) AALEPFQTEK PA
0
100-120 (21) DSVSVSDALGSCIIDCNENTR PA
0
126-162 (37) ETEGLHCEYVAEPVMAQSTQNVDYNQLQEVIYPETLK PA
1
167-179 (13) GPELVGPSESKPR PA
7
180-197 (18) GTSHLPAGQVPVTLQPQK PA
0
204-240 (37) TQPPVAYQYWPPAELQYRPPPESQYGYPGMPPAPQGR PA
6
241-249 (9) APYPQPPTR PA
7
251-259 (9) LNPTAPPSR PA
8
260-270 (11) QGSELHEIIDK PA
7
274-306 (33) EGDTEAWQFPVTLEPMPPGEGAQEGEPPTVEAR PA
7
324-333 (10) QYGPNSPYMR PA
9
334-344 (11) TLLDSIAHGHR PA
7
345-355 (11) LIPYDWEILAK PA
9
356-367 (12) SSLSPSQFLQFK PA
8
368-379 (12) TWWIDGVQEQVR PA
9
383-420 (38) AANPPVNIDADQLLGIGQNWSTISQQALMQNEAIEQVR PA
9
430-444 (15) IQDPGSTCPSFNTVR PA
8
449-457 (9) EPYPDFVAR PA
10
474-496 (23) VIVELMAYENANPECQSAIKPLK PA
9
499-511 (13) VPAGSDVISEYVK PA
9
512-522 (11) ACDGIGGAMHK PA
8
523-540 (18) AMLMAQAITGVVLGGQVR PA
9
546-556 (11) CYNCGQIGHLK PA
10
565-576 (12) QNITIQATTTGR PA
9
577-584 (8) EPPDLCPR PA
9
602-612 (11) NGQPLSGNEQR PA
9
613-666 (54) GQPQAPQQTGAFPIQPFVPQGFQEQQPPLSQVFQGISQLPQYNNCPPPQAAVQQ PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center