Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P78357-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
6-36 (31) LFCILLAAVSGAEGWGYYGCDEELVGPLYAR PA
0
37-51 (15) SLGASSYYSLLTAPR PA
0
55-64 (10) LHGISGWSPR PA
0
65-78 (14) IGDPNPWLQIDLMK PA
0
84-99 (16) AVATQGSFNSWDWVTR PA
0
100-107 (8) YMLLYGDR PA
0
108-117 (10) VDSWTPFYQR PA
0
118-134 (17) GHNSTFFGNVNESAVVR PA
0
135-144 (10) HDLHFHFTAR PA
0
148-156 (9) IVPLAWNPR PA
0
163-171 (9) LGLYGCPYK PA
0
172-186 (15) ADILYFDGDDAISYR PA
0
194-204 (11) SLWDVFAFSFK PA
0
209-267 (59) DGLLLHAEGAQGDYVTLELEGAHLLLHMSLGSSPIQPRPGHTTVSAGGVLNDQHWHYVR PA
0
274-285 (12) DVNFTLDGYVQR PA
0
286-294 (9) FILNGDFER PA
0
295-311 (17) LNLDTEMFIGGLVGAAR PA
0
322-331 (10) GCIENVIFNR PA
0
332-340 (9) VNIADLAVR PA
0
355-379 (25) CLDPVPHPINFGGPHNFVQVPGFPR PA
0
391-402 (12) TWDLTGLLLFSR PA
0
403-428 (26) LGDGLGHVELTLSEGQVNVSIAQSGR PA
0
431-438 (8) LQFAAGYR PA
0
439-469 (31) LNDGFWHEVNFVAQENHAVISIDDVEGAEVR PA
0
470-477 (8) VSYPLLIR PA
0
478-493 (16) TGTSYFFGGCPKPASR PA
0
494-511 (18) WDCHSNQTAFHGCMELLK PA
0
512-525 (14) VDGQLVNLTLVEGR PA
0
527-543 (17) LGFYAEVLFDTCGITDR PA
0
544-554 (11) CSPNMCEHDGR PA
0
555-572 (18) CYQSWDDFICYCELTGYK PA
0
573-582 (10) GETCHTPLYK PA
0
594-618 (25) TSGNFTIDPDGSGPLKPFVVYCDIR PA
0
636-681 (46) VTGSSMERPFLGAIQYWNASWEEVSALANASQHCEQWIEFSCYNSR PA
0
682-697 (16) LLNTAGGYPYSFWIGR PA
0
698-714 (17) NEEQHFYWGGSQPGIQR PA
0
722-740 (19) SCVDPALYCNCDADQPQWR PA
0
744-764 (21) GLLTFVDHLPVTQVVIGDTNR PA
0
765-777 (13) STSEAQFFLRPLR PA
0
783-797 (15) NSWNTISFHTGAALR PA
0
803-814 (12) ANHSLDVSFYFR PA
0
815-834 (20) TSAPSGVFLENMGGPYCQWR PA
0
847-879 (33) DVVFAFDVGNGDENLTVHSDDFEFNDDEWHLVR PA
0
891-923 (33) VDHRPWVLRPMPLQTYIWMEYDQPLYVGSAELK PA
0
925-932 (8) RPFVGCLR PA
0
936-946 (11) LNGVTLNLEGR PA
0
947-965 (19) ANASEGTSPNCTGHCAHPR PA
0
966-973 (8) LPCFHGGR PA
0
978-1010 (33) YSYYTCDCDLTAFDGPYCNHDIGGFFEPGTWMR PA
0
1011-1018 (8) YNLQSALR PA
0
1023-1058 (36) EFSHMLSRPVPGYEPGYIPGYDTPGYVPGYHGPGYR PA
0
1059-1073 (15) LPDYPRPGRPVPGYR PA
0
1074-1105 (32) GPVYNVTGEEVSFSFSTSSAPAVLLYVSSFVR PA
0
1106-1113 (8) DYMAVLIK PA
0
1114-1121 (8) DDGTLQLR PA
0
1122-1150 (29) YQLGTSPYVYQLTTRPVTDGQPHSINITR PA
0
1154-1168 (15) NLFIQVDYFPLTEQK PA
0
1169-1181 (13) FSLLVDSQLDSPK PA
0
1188-1200 (13) VMETGVIDPEIQR PA
0
1201-1214 (14) YNTPGFSGCLSGVR PA
0
1215-1222 (8) FNNVAPLK PA
0
1227-1240 (14) TPRPMTAELAEALR PA
0
1241-1255 (15) VQGELSESNCGAMPR PA
0
1256-1310 (55) LVSEVPPELDPWYLPPDFPYYHDEGWVAILLGFLVAFLLLGLVGMLVLFYLQNHR PA
0
1313-1321 (9) GSYHTNEPK PA
0
1322-1370 (49) AAHEYHPGSKPPLPTSGPAQVPTPTAAPNQAPASAPAPAPTPAPAPGPR PA
0
1371-1382 (12) DQNLPQILEESR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center