Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P78362-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
8-19 (12) SSSSERPEPQQK PA
0
20-65 (46) APLVPPPPPPPPPPPPPLPDPTPPEPEEEILGSDDEEQEDPADYCK PA
1
73-80 (8) IGDLFNGR PA
4
87-104 (18) LGWGHFSTVWLCWDMQGK PA
1
114-127 (14) SAQHYTETALDEIK PA
1
134-142 (9) ESDPSDPNK PA
1
143-153 (11) DMVVQLIDDFK PA
1
154-175 (22) ISGMNGIHVCMVFEVLGHHLLK PA
1
180-188 (9) SNYQGLPVR PA
1
196-207 (12) QVLQGLDYLHSK PA
1
210-230 (21) IIHTDIKPENILMCVDDAYVR PA
1
232-241 (10) MAAEATEWQK PA
1
242-263 (22) AGAPPPSGSAVSTAPQQKPIGK PA
1
287-295 (9) LQEIEELER PA
1
301-324 (24) IIEENITSAAPSNDQDGEYCPEVK PA
1
327-340 (14) TTGLEEAAEAETAK PA
1
341-351 (11) DNGEAEDQEEK PA
1
362-382 (21) DEDDVDQELANIDPTWIESPK PA
1
383-442 (60) TNGHIENGPFSLEQQLDDEDDDEEDCPNPEEYNLDEPNAESDYTYSSSYEQFNGELPNGR PA
1
445-489 (45) IPESQFPEFSTSLFSGSLEPVACGSVLSEGSPLTEQEESSPSHDR PA
1
492-503 (12) TVSASSTGDLPK PA
1
508-519 (12) AADLLVNPLDPR PA
1
528-539 (12) IADLGNACWVHK PA
8
540-548 (9) HFTEDIQTR PA
8
552-594 (43) SIEVLIGAGYSTPADIWSTACMAFELATGDYLFEPHSGEDYSR PA
1
595-611 (17) DEDHIAHIIELLGSIPR PA
1
636-648 (13) LKPWSLFDVLVEK PA
1
649-673 (25) YGWPHEDAAQFTDFLIPMLEMVPEK PA
1
675-682 (8) ASAGECLR PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center