Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P78362-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
31-76 (46) APLVPPPPPPPPPPPPPLPDPTPPEPEEEILGSDDEEQEDPADYCK PA
1
84-91 (8) IGDLFNGR PA
4
98-115 (18) LGWGHFSTVWLCWDMQGK PA
1
125-138 (14) SAQHYTETALDEIK PA
1
145-153 (9) ESDPSDPNK PA
1
154-164 (11) DMVVQLIDDFK PA
1
165-186 (22) ISGMNGIHVCMVFEVLGHHLLK PA
1
191-199 (9) SNYQGLPVR PA
1
207-218 (12) QVLQGLDYLHSK PA
1
221-241 (21) IIHTDIKPENILMCVDDAYVR PA
1
243-252 (10) MAAEATEWQK PA
1
253-274 (22) AGAPPPSGSAVSTAPQQKPIGK PA
1
298-306 (9) LQEIEELER PA
1
312-335 (24) IIEENITSAAPSNDQDGEYCPEVK PA
1
338-351 (14) TTGLEEAAEAETAK PA
1
352-362 (11) DNGEAEDQEEK PA
1
373-393 (21) DEDDVDQELANIDPTWIESPK PA
1
394-453 (60) TNGHIENGPFSLEQQLDDEDDDEEDCPNPEEYNLDEPNAESDYTYSSSYEQFNGELPNGR PA
1
456-500 (45) IPESQFPEFSTSLFSGSLEPVACGSVLSEGSPLTEQEESSPSHDR PA
1
503-514 (12) TVSASSTGDLPK PA
1
519-530 (12) AADLLVNPLDPR PA
1
539-550 (12) IADLGNACWVHK PA
8
551-559 (9) HFTEDIQTR PA
8
563-605 (43) SIEVLIGAGYSTPADIWSTACMAFELATGDYLFEPHSGEDYSR PA
1
606-622 (17) DEDHIAHIIELLGSIPR PA
1
647-659 (13) LKPWSLFDVLVEK PA
1
660-684 (25) YGWPHEDAAQFTDFLIPMLEMVPEK PA
1
686-693 (8) ASAGECLR PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center