Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P78368-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
32-47 (16) SSGTSSGVLMVGPNFR PA
0
52-61 (10) IGCGNFGELR PA
6
65-75 (11) NLYTNEYVAIK PA
6
83-91 (9) APQLHLEYR PA
7
95-113 (19) QLSATEGVPQVYYFGPCGK PA
0
114-135 (22) YNAMVLELLGPSLEDLFDLCDR PA
7
141-152 (12) TVLMIAIQLITR PA
0
165-179 (15) DVKPENFLVGRPGTK PA
0
181-193 (13) QHAIHIIDFGLAK PA
0
194-201 (8) EYIDPETK PA
8
218-227 (10) YMSINTHLGK PA
8
233-247 (15) DDLEALGHMFMYFLR PA
8
248-256 (9) GSLPWQGLK PA
8
273-292 (20) ATPIEVLCENFPEEMATYLR PA
2
297-309 (13) LDFFEKPDYDYLR PA
6
311-318 (8) LFTDLFDR PA
6
319-352 (34) SGFVFDYEYDWAGKPLPTPIGTVHTDLPSQPQLR PA
0
361-398 (38) NQALNSTNGELNADDPTAGHSNAPITAPAEVEVADETK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center