Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P78417-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
12-25 (14) GSAPPGPVPEGSIR PA
1
49-57 (9) HEVININLK PA
2
58-65 (8) NKPEWFFK PA
2
67-100 (34) NPFGLVPVLENSQGQLIYESAITCEYLDEAYPGK PA
2
102-110 (9) LLPDDPYEK PA
2
115-122 (8) MILELFSK PA
2
123-132 (10) VPSLVGSFIR PA
1
153-160 (8) LEEVLTNK PA
1
162-183 (22) TTFFGGNSISMIDYLIWPWFER PA
2
189-198 (10) LNECVDHTPK PA
2
208-220 (13) EDPTVSALLTSEK PA
2
221-241 (21) DWQGFLELYLQNSPEACDYGL PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2018 (C) Yonsei Proteome Research Center