Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P78417-3)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
21-29 (9) HEVININLK PA
2
30-37 (8) NKPEWFFK PA
2
39-72 (34) NPFGLVPVLENSQGQLIYESAITCEYLDEAYPGK PA
2
74-82 (9) LLPDDPYEK PA
2
87-94 (8) MILELFSK PA
2
95-104 (10) VPSLVGSFIR PA
1
125-132 (8) LEEVLTNK PA
1
134-155 (22) TTFFGGNSISMIDYLIWPWFER PA
2
161-170 (10) LNECVDHTPK PA
2
180-192 (13) EDPTVSALLTSEK PA
2
193-213 (21) DWQGFLELYLQNSPEACDYGL PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2018 (C) Yonsei Proteome Research Center