Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P80404-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-9 (9) MASMLLAQR PA
0
10-19 (10) LACSFQHSYR PA
0
27-34 (8) HISQAAAK PA
0
35-47 (13) VDVEFDYDGPLMK PA
0
61-81 (21) QLNIIQNAEAVHFFCNYEESR PA
0
82-92 (11) GNYLVDVDGNR PA
0
93-114 (22) MLDLYSQISSVPIGYSHPALLK PA
0
115-142 (28) LIQQPQNASMFVNRPALGILPPENFVEK PA
0
145-153 (9) QSLLSVAPK PA
0
154-173 (20) GMSQLITMACGSCSNENALK PA
0
188-220 (33) GFSQEELETCMINQAPGCPDYSILSFMGAFHGR PA
0
221-231 (11) TMGCLATTHSK PA
0
236-250 (15) IDIPSFDWPIAPFPR PA
0
253-260 (8) YPLEEFVK PA
0
261-268 (8) ENQQEEAR PA
0
269-279 (11) CLEEVEDLIVK PA
0
286-310 (25) TVAGIIVEPIQSEGGDNHASDDFFR PA
0
319-337 (19) HGCAFLVDEVQTGGGCTGK PA
0
338-357 (20) FWAHEHWGLDDPADVMTFSK PA
0
359-367 (9) MMTGGFFHK PA
0
368-377 (10) EEFRPNAPYR PA
0
378-388 (11) IFNTWLGDPSK PA
0
389-400 (12) NLLLAEVINIIK PA
0
402-413 (12) EDLLNNAAHAGK PA
0
414-425 (12) ALLTGLLDLQAR PA
0
437-450 (14) GTFCSFDTPDDSIR PA
0
461-470 (10) GVVLGGCGDK PA
0
474-481 (8) FRPTLVFR PA
0
482-500 (19) DHHAHLFLNIFSDILADFK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center