Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P82979-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-10 (10) MATETVELHK PA
0
38-73 (36) LQAYLEEHAEEEANEEDVLGDETEEEETKPIELPVK PA
0
81-88 (8) TVDVAAEK PA
0
93-102 (10) ITSEIPQTER PA
0
110-119 (10) FNVPVSLESK PA
0
127-135 (9) FGISSVPTK PA
0
136-149 (14) GLSSDNKPMVNLDK PA
0
157-166 (10) FGLNVSSISR PA
0
181-199 (19) FGIVTSSAGTGTTEDTEAK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center