Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q02413-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-9 (9) MQDLGGGER PA
0
10-20 (11) MTGFELTEGVK PA
1
21-36 (16) TSGMPEICQEYSGTLR PA
1
45-60 (16) EGGLNMNFMESYFCQK PA
1
61-113 (53) AYAYADEDEGRPSNDCLLIYDIEGVGSPAGSVGCCSFIGEDLDDSFLDTLGPK PA
1
117-124 (8) LADISLGK PA
1
125-226 (102) ESYPDLDPSWPPQSTEPVCLPQETEPVVSGHPPISPHFGTTTVISESTYPSGPGVLHPKPILDPLGYGNVTVTESYTTSD
TLKPSVHVHDNRPASNVVVTER PA
1
227-246 (20) VVGPISGADLHGMLEMPDLR PA
1
247-256 (10) DGSNVIVTER PA
1
257-274 (18) VIAPSSSLPTSLTIHHPR PA
1
275-284 (10) ESSNVVVTER PA
1
285-313 (29) VIQPTSGMIGSLSMHPELANAHNVIVTER PA
1
314-375 (62) VVSGAGVTGISGTTGISGGIGSSGLVGTSMGAGSGALSGAGISGGGIGLSSLGGTASIGHMR PA
1
376-395 (20) SSSDHHFNQTIGSASPSTAR PA
1
401-408 (8) YSTVQYSK PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center