Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q02556-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
12-33 (22) QWLIEQIDSSMYPGLIWENEEK PA
0
46-58 (13) QDYNQEVDASIFK PA
0
89-98 (10) SPDFEEVTDR PA
0
99-108 (10) SQLDISEPYK PA
0
112-119 (8) IVPEEEQK PA
0
122-140 (19) LGVATAGCVNEVTEMECGR PA
0
141-148 (8) SEIDELIK PA
0
149-160 (12) EPSVDDYMGMIK PA
0
162-170 (9) SPSPPEACR PA
0
171-214 (44) SQLLPDWWAQQPSTGVPLVTGYTTYDAHHSAFSQMVISFYYGGK PA
0
215-228 (14) LVGQATTTCPEGCR PA
0
229-240 (12) LSLSQPGLPGTK PA
0
241-251 (11) LYGPEGLELVR PA
0
252-262 (11) FPPADAIPSER PA
0
277-284 (8) GVLLHSSR PA
0
297-307 (11) VFCSGNAVVCK PA
0
316-329 (14) DEVVQVFDTSQFFR PA
0
330-340 (11) ELQQFYNSQGR PA
0
346-361 (16) VVLCFGEEFPDMAPLR PA
0
364-375 (12) LILVQIEQLYVR PA
0
376-383 (8) QLAEEAGK PA
0
384-404 (21) SCGAGSVMQAPEEPPPDQVFR PA
0
405-415 (11) MFPDICASHQR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center