Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q05BV3-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
5-12 (8) SAPSCHLR PA
3
13-20 (8) LEWVYGYR PA
10
26-34 (9) NNLYYTAAK PA
3
35-50 (16) EIVYFVAGVGVVYSPR PA
3
59-73 (15) GHSDDIISLALHPER PA
3
74-83 (10) VLVATGQVGK PA
3
84-102 (19) EPYICIWDSYTVQTISVLK PA
3
103-120 (18) DVHTHGIACLAFDLDGQR PA
3
121-129 (9) LVSVGLDSK PA
3
130-138 (9) NAVCVWDWK PA
3
142-152 (11) MLSMAPGHTDR PA
3
153-165 (13) IFDISWDLYQPNK PA
3
176-187 (12) FWSLCGNALTPK PA
3
194-207 (14) TGDLQTILCLACAR PA
3
208-224 (17) DELTYSGALNGDIYVWK PA
3
231-255 (25) TIQGAHAAGIFSMNACEEGFATGGR PA
3
261-275 (15) LWDLTFKPITVIDLR PA
3
293-313 (21) GDHILVGTQDSEIFEIVVQER PA
3
314-347 (34) NKPFLIMQGHCEGELWALAVHPTKPLAVTGSDDR PA
3
351-362 (12) IWSLVDHALIAR PA
3
363-370 (8) CNMEEPIR PA
3
371-386 (16) CAAVNADGIHLALGMK PA
3
387-394 (8) DGSFTVLR PA
3
397-405 (9) DMTEVVHIK PA
5
416-440 (25) YSPDGTYLAVGCNDSSVDIYGVAQR PA
3
444-464 (21) VGECLGSLSFITHLDWSSDSR PA
3
465-474 (10) YLQTNDGNGK PA
3
485-493 (9) EVTSTEEIK PA
3
494-514 (21) GVHWASWTCVSGLEVNGIWPK PA
3
515-543 (29) YSDINDINSVDGNYIGQVLVTADDYGIIK PA
3
559-570 (12) YIGHSAHVTNVR PA
3
571-592 (22) WSHDYQWVISIGGADHSVFQWK PA
3
601-642 (42) DAVHIAPQESLADSHSDESDSDLSDVPELDSEIEQETQLTYR PA
2
679-686 (8) LHFVHGYR PA
2
692-715 (24) SNLFYTQIGEIVYHVAAVGVIYNR PA
2
722-739 (18) FYLGHDDDILCLTIHPLK PA
2
740-749 (10) DYVATGQVGR PA
4
750-768 (19) DPSIHIWDTETIKPLSILK PA
2
769-785 (17) GHHQYGVSAVDFSADGK PA
2
787-804 (18) LASVGIDDSHTVVLWDWK PA
2
824-831 (8) MNPYVPDK PA
2
846-853 (8) AGGGLIGR PA
2
855-862 (8) GYIGTLGK PA
2
863-891 (29) NDTMMCAVYGWTEEMAFSGTSTGDVCIWR PA
2
901-914 (14) AHDGPVFSMHALEK PA
2
922-934 (13) DGIVALWDDSFER PA
2
944-951 (8) AALAPGSK PA
2
952-962 (11) GLLLEDNPSIR PA
4
963-976 (14) AISLGHGHILVGTK PA
2
977-985 (9) NGEILEVDK PA
2
986-1020 (35) SGPITLLVQGHMEGEVWGLATHPYLPICATVSDDK PA
2
1024-1037 (14) IWDLSPSHCMLAVR PA
2
1045-1053 (9) CCCFSPDGK PA
2
1054-1081 (28) ALAVGLNDGSFLMANADTLEDLVSFHHR PA
2
1097-1116 (20) YLAVASHDSFIDIYNVMSSK PA
2
1123-1136 (14) GATSYITHIDWDIR PA
2
1137-1144 (8) AFTGQHWC PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center