Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q05BV3-5)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
5-12 (8) SAPSCHLR PA
3
13-20 (8) LEWVYGYR PA
10
26-34 (9) NNLYYTAAK PA
3
35-50 (16) EIVYFVAGVGVVYSPR PA
3
59-73 (15) GHSDDIISLALHPER PA
3
74-83 (10) VLVATGQVGK PA
3
84-102 (19) EPYICIWDSYTVQTISVLK PA
3
103-120 (18) DVHTHGIACLAFDLDGQR PA
3
121-129 (9) LVSVGLDSK PA
3
130-138 (9) NAVCVWDWK PA
3
142-152 (11) MLSMAPGHTDR PA
3
153-165 (13) IFDISWDLYQPNK PA
3
176-187 (12) FWSLCGNALTPK PA
3
194-207 (14) TGDLQTILCLACAR PA
3
208-224 (17) DELTYSGALNGDIYVWK PA
3
231-255 (25) TIQGAHAAGIFSMNACEEGFATGGR PA
3
261-275 (15) LWDLTFKPITVIDLR PA
3
293-313 (21) GDHILVGTQDSEIFEIVVQER PA
3
314-347 (34) NKPFLIMQGHCEGELWALAVHPTKPLAVTGSDDR PA
3
351-362 (12) IWSLVDHALIAR PA
3
363-370 (8) CNMEEPIR PA
3
371-386 (16) CAAVNADGIHLALGMK PA
3
387-394 (8) DGSFTVLR PA
3
397-405 (9) DMTEVVHIK PA
5
416-440 (25) YSPDGTYLAVGCNDSSVDIYGVAQR PA
3
444-464 (21) VGECLGSLSFITHLDWSSDSR PA
3
465-474 (10) YLQTNDGNGK PA
3
485-493 (9) EVTSTEEIK PA
3
494-514 (21) GVHWASWTCVSGLEVNGIWPK PA
3
515-543 (29) YSDINDINSVDGNYIGQVLVTADDYGIIK PA
3
559-570 (12) YIGHSAHVTNVR PA
3
571-592 (22) WSHDYQWVISIGGADHSVFQWK PA
3
601-642 (42) DAVHIAPQESLADSHSDESDSDLSDVPELDSEIEQETQLTYR PA
2
679-686 (8) LHFVHGYR PA
2
692-715 (24) SNLFYTQIGEIVYHVAAVGVIYNR PA
2
722-739 (18) FYLGHDDDILCLTIHPLK PA
2
740-749 (10) DYVATGQVGR PA
4
750-768 (19) DPSIHIWDTETIKPLSILK PA
2
769-785 (17) GHHQYGVSAVDFSADGK PA
2
787-804 (18) LASVGIDDSHTVVLWDWK PA
2
824-831 (8) MNPYVPDK PA
2
846-853 (8) AGGGLIGR PA
2
855-862 (8) GYIGTLGK PA
2
863-891 (29) NDTMMCAVYGWTEEMAFSGTSTGDVCIWR PA
2
901-914 (14) AHDGPVFSMHALEK PA
2
922-934 (13) DGIVALWDDSFER PA
2
944-951 (8) AALAPGSK PA
2
952-962 (11) GLLLEDNPSIR PA
4
963-976 (14) AISLGHGHILVGTK PA
2
977-985 (9) NGEILEVDK PA
2
986-1020 (35) SGPITLLVQGHMEGEVWGLATHPYLPICATVSDDK PA
2
1024-1037 (14) IWDLSPSHCMLAVR PA
2
1045-1053 (9) CCCFSPDGK PA
2
1054-1081 (28) ALAVGLNDGSFLMANADTLEDLVSFHHR PA
2
1097-1116 (20) YLAVASHDSFIDIYNVMSSK PA
2
1123-1136 (14) GATSYITHIDWDIR PA
2
1139-1147 (9) LLQVNTGAK PA
1
1148-1156 (9) EQLFFEAPR PA
3
1160-1169 (10) QTIPSVEVEK PA
1
1170-1205 (36) IAWASWTSVLGLCCEGIWPVIGEVTDVTASCLTSDK PA
1
1206-1218 (13) MVLATGDDLGFVK PA
1
1234-1245 (12) YVAHSTHVTNVR PA
1
1246-1274 (29) WTYDDSMLVTLGGTDMSLMVWTNEMEGYR PA
1
1277-1300 (24) RPCDSEESDIDSEEDGGYDSDVTR PA
1
1301-1309 (9) ENEISYTIR PA
1
1310-1328 (19) ALSTNIRPMLGIKPHLQQK PA
1
1341-1348 (8) GSRPPVSR PA
0
1356-1363 (8) LQTNNVGK PA
1
1366-1380 (15) RPIEDLVLELIFGYR PA
1
1386-1435 (50) NNVHYLNDGDDIIYHTASVGILHNVATGSQSFYQEHNDDILCLTVNQHPK PA
1
1436-1466 (31) FINIVATGQVGDSADMSATAPSIHIWDAMNK PA
1
1479-1490 (12) GVCSVSFSATGK PA
1
1491-1507 (17) LLLSVGLDPEHTITIWR PA
1
1524-1543 (20) IFVAEFRPDSDTQFVSVGVK PA
1
1560-1569 (10) GLLSTLEDAR PA
1
1570-1597 (28) MQTMLAIAFGANNLTFTGTISGDVCVWK PA
1
1608-1621 (14) AHNGPVFAMYTTLR PA
1
1622-1630 (9) DGLIVTGGK PA
3
1655-1665 (11) LETGQATDCVR PA
1
1680-1689 (10) NAEIIEVGEK PA
1
1690-1714 (25) NAACNILVNGHVDGPIWGLATHPSR PA
1
1715-1727 (13) DFFLSAAEDGTVR PA
1
1740-1747 (8) VNLGHAAR PA
1
1748-1763 (16) TVCYSPEGDMVAIGMK PA
1
1764-1776 (13) NGEFIILLVSSLK PA
1
1799-1822 (24) YLAVGSSENSVDFYDLTLGPTLNR PA
1
1828-1853 (26) DIPSFVIQMDFSADSSYLQVSSGCYK PA
1
1855-1863 (9) HVYEVPSGK PA
1
1864-1873 (10) HLMDHAAIDR PA
1
1874-1893 (20) ITWATWTSILGDEVLGIWSR PA
1
1898-1922 (25) ADVNCACVSHSGISLVTGDDFGMVK PA
1
1923-1931 (9) LFDFPCPEK PA
1
1938-1949 (12) FLGHSPHVTNIR PA
1
1956-1971 (16) HVVSAGGDDCSLFVWK PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center