Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q06136-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-46 (46) MLLLAAAFLVAFVLLLYMVSPLISPKPLALPGAHVVVTGGSSGIGK PA
1
47-54 (8) CIAIECYK PA
1
55-64 (10) QGAFITLVAR PA
1
75-84 (10) EIEMHSINDK PA
1
85-106 (22) QVVLCISVDVSQDYNQVENVIK PA
1
112-129 (18) LGPVDMLVNCAGMAVSGK PA
1
130-165 (36) FEDLEVSTFEVKPYNVYITVAYPPDTDTPGFAEENR PA
0
173-188 (16) LISETTSVCKPEQVAK PA
1
193-237 (45) DAIQGNFNSSLGSDGYMLSALTCGMAPVTSITEGLQQVVTMGLFR PA
1
238-252 (15) TIALFYLGSFDSIVR PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center