Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q07890-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-18 (18) MQQAPQPYEFFSEENSPK PA
1
21-28 (8) GLLVSALR PA
1
30-58 (29) VQEQVHPTLSANEESLYYIEELIFQLLNK PA
1
66-73 (8) TVQDVEER PA
1
77-84 (8) TFPHPIDK PA
1
85-96 (12) WAIADAQSAIEK PA
3
101-109 (9) NPLLLPVDK PA
1
122-143 (22) VDYHVSLYIVAVLEYISADILK PA
1
144-153 (10) LAGNYVFNIR PA
1
154-163 (10) HYEISQQDIK PA
1
171-204 (34) VLMDMFDQDDIGLVSLCEDEPSSSGELNYYDLVR PA
1
234-242 (9) LFKPSDIEK PA
1
243-256 (14) IFSNISDIHELTVK PA
1
257-311 (55) LLGLIEDTVEMTDESSPHPLAGSCFEDLAEEQAFDPYETLSQDILSPEFHEHFNK PA
1
312-330 (19) LMARPAVALHFQSIADGFK PA
0
340-356 (17) LMLVPVYHCWHYFELLK PA
0
360-368 (9) ACSEEQEDR PA
1
369-387 (19) ECLNQAITALMNLQGSMDR PA
1
397-411 (15) RPGDPVCPFYSHQLR PA
1
426-433 (8) NIDGWEGK PA
2
434-450 (17) DIGQCCNEFIMEGPLTR PA
1
458-477 (20) HIFLFDGLMISCKPNHGQTR PA
1
478-487 (10) LPGYSSAEYR PA
1
510-517 (8) HAFELVSK PA
1
518-527 (10) DENSIIFAAK PA
1
533-545 (13) NNWMAALISLHYR PA
1
551-558 (8) MLDSVLLK PA
1
559-566 (8) EENEQPLR PA
1
567-574 (8) LPSPEVYR PA
1
579-593 (15) DSEENIVFEDNLQSR PA
1
611-623 (13) LTYHMYADPNFVR PA
2
631-645 (15) SFCKPQELLSLLIER PA
1
646-658 (13) FEIPEPEPTDADK PA
1
664-673 (10) GEQPISADLK PA
1
678-686 (9) EYVQPVQLR PA
1
693-704 (12) HWVEHHFYDFER PA
2
712-720 (9) LESFISSVR PA
1
740-784 (45) QAQANGVSHNITFESPPPPIEWHISKPGQFETFDLMTLHPIEIAR PA
1
785-795 (11) QLTLLESDLYR PA
2
797-809 (13) VQPSELVGSVWTK PA
1
813-821 (9) EINSPNLLK PA
2
825-835 (11) HTTNLTLWFEK PA
2
836-846 (11) CIVEAENFEER PA
1
853-883 (31) IIEILQVFQDLNNFNGVLEIVSAVNSVSVYR PA
1
884-894 (11) LDHTFEALQER PA
1
898-911 (14) ILDEAVELSQDHFK PA
1
919-937 (19) SINPPCVPFFGIYLTNILK PA
2
938-947 (10) TEEGNNDFLK PA
1
962-980 (19) VAEITGEIQQYQNQPYCLR PA
2
988-1001 (14) FFENLNPMGSASEK PA
1
1002-1010 (9) EFTDYLFNK PA
2
1035-1044 (10) SPGIRPNTGR PA
1
1045-1053 (9) HGSTSGTLR PA
1
1054-1061 (8) GHPTPLER PA
1
1071-1127 (57) IAETELESTVSAPTSPNTPSTPPVSASSDLSVFLDVDLNSSCGSNSIFAPVLLPHSK PA
1
1128-1138 (11) SFFSSCGSLHK PA
1
1139-1152 (14) LSEEPLIPPPLPPR PA
1
1155-1163 (9) FDHDASNSK PA
1
1168-1178 (11) SDDDPPAIPPR PA
1
1189-1209 (21) VPVPTGAFDGPLHSPPPPPPR PA
1
1210-1244 (35) DPLPDTPPPVPLRPPEHFINCPFNLQPPPLGHLHR PA
1
1251-1269 (19) DISTCPNSPSTPPSTPSPR PA
1
1274-1295 (22) CYVLSSSQNNLAHPPAPPVPPR PA
1
1296-1304 (9) QNSSPHLPK PA
1
1313-1321 (9) ELSHPPLYR PA
1
1322-1332 (11) LPLLENAETPQ PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center