Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q07890-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-18 (18) MQQAPQPYEFFSEENSPK PA
1
21-28 (8) GLLVSALR PA
1
30-58 (29) VQEQVHPTLSANEESLYYIEELIFQLLNK PA
1
66-73 (8) TVQDVEER PA
1
77-84 (8) TFPHPIDK PA
1
85-96 (12) WAIADAQSAIEK PA
3
101-109 (9) NPLLLPVDK PA
1
122-143 (22) VDYHVSLYIVAVLEYISADILK PA
1
144-153 (10) LAGNYVFNIR PA
1
154-163 (10) HYEISQQDIK PA
1
171-204 (34) VLMDMFDQDDIGLVSLCEDEPSSSGELNYYDLVR PA
1
234-242 (9) LFKPSDIEK PA
1
243-256 (14) IFSNISDIHELTVK PA
1
257-311 (55) LLGLIEDTVEMTDESSPHPLAGSCFEDLAEEQAFDPYETLSQDILSPEFHEHFNK PA
1
312-326 (15) LMARPAVALHFQQLK PA
0
327-335 (9) ACSEEQEDR PA
1
336-354 (19) ECLNQAITALMNLQGSMDR PA
1
364-378 (15) RPGDPVCPFYSHQLR PA
1
393-400 (8) NIDGWEGK PA
2
401-417 (17) DIGQCCNEFIMEGPLTR PA
1
425-444 (20) HIFLFDGLMISCKPNHGQTR PA
1
445-454 (10) LPGYSSAEYR PA
1
477-484 (8) HAFELVSK PA
1
485-494 (10) DENSIIFAAK PA
1
500-512 (13) NNWMAALISLHYR PA
1
518-525 (8) MLDSVLLK PA
1
526-533 (8) EENEQPLR PA
1
534-541 (8) LPSPEVYR PA
1
546-560 (15) DSEENIVFEDNLQSR PA
1
578-590 (13) LTYHMYADPNFVR PA
2
598-612 (15) SFCKPQELLSLLIER PA
1
613-625 (13) FEIPEPEPTDADK PA
1
631-640 (10) GEQPISADLK PA
1
645-653 (9) EYVQPVQLR PA
1
660-671 (12) HWVEHHFYDFER PA
2
679-687 (9) LESFISSVR PA
1
707-751 (45) QAQANGVSHNITFESPPPPIEWHISKPGQFETFDLMTLHPIEIAR PA
1
752-762 (11) QLTLLESDLYR PA
2
764-776 (13) VQPSELVGSVWTK PA
1
780-788 (9) EINSPNLLK PA
2
792-802 (11) HTTNLTLWFEK PA
2
803-813 (11) CIVEAENFEER PA
1
820-850 (31) IIEILQVFQDLNNFNGVLEIVSAVNSVSVYR PA
1
851-861 (11) LDHTFEALQER PA
1
865-878 (14) ILDEAVELSQDHFK PA
1
886-904 (19) SINPPCVPFFGIYLTNILK PA
2
905-914 (10) TEEGNNDFLK PA
1
929-947 (19) VAEITGEIQQYQNQPYCLR PA
2
955-968 (14) FFENLNPMGSASEK PA
1
969-977 (9) EFTDYLFNK PA
2
1002-1011 (10) SPGIRPNTGR PA
1
1012-1020 (9) HGSTSGTLR PA
1
1021-1028 (8) GHPTPLER PA
1
1038-1094 (57) IAETELESTVSAPTSPNTPSTPPVSASSDLSVFLDVDLNSSCGSNSIFAPVLLPHSK PA
1
1095-1105 (11) SFFSSCGSLHK PA
1
1106-1119 (14) LSEEPLIPPPLPPR PA
1
1122-1130 (9) FDHDASNSK PA
1
1135-1145 (11) SDDDPPAIPPR PA
1
1156-1176 (21) VPVPTGAFDGPLHSPPPPPPR PA
1
1177-1211 (35) DPLPDTPPPVPLRPPEHFINCPFNLQPPPLGHLHR PA
1
1218-1236 (19) DISTCPNSPSTPPSTPSPR PA
1
1241-1262 (22) CYVLSSSQNNLAHPPAPPVPPR PA
1
1263-1271 (9) QNSSPHLPK PA
1
1280-1288 (9) ELSHPPLYR PA
1
1289-1299 (11) LPLLENAETPQ PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center