Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q08554-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-14 (14) MALASAAPGSIFCK PA
1
15-32 (18) QLLFSLLVLTLLCDACQK PA
1
37-49 (13) VPSHLQAETLVGK PA
1
50-57 (8) VNLEECLK PA
1
71-89 (19) ILEDGSIYTTHDLILSSER PA
1
91-101 (11) SFSIFLSDGQR PA
1
136-179 (44) WAPIPASLMENSLGPFPQHVQQIQSDAAQNYTIFYSISGPGVDK PA
1
180-189 (10) EPFNLFYIEK PA
1
190-198 (9) DTGDIFCTR PA
1
205-231 (27) YEQFALYGYATTADGYAPEYPLPLIIK PA
1
232-245 (14) IEDDNDNAPYFEHR PA
1
246-256 (11) VTIFTVPENCR PA
1
264-278 (15) VTATDLDEPDTLHTR PA
1
283-292 (10) ILQQIPDHPK PA
1
293-312 (20) HFSIHPDTGVITTTTPFLDR PA
1
315-325 (11) CDTYQLIMEVR PA
1
326-367 (42) DMGGQPFGLFNTGTITISLEDENDNPPSFTETSYVTEVEENR PA
1
377-389 (13) VQDQDLPNTPHSK PA
1
394-428 (35) ILQGNENGNFIISTDPNTNEGVLCVVKPLNYEVNR PA
1
429-444 (16) QVILQVGVINEAQFSK PA
1
445-461 (17) AASSQTPTMCTTTVTVK PA
1
462-476 (15) IIDSDEGPECHPPVK PA
1
477-494 (18) VIQSQDGFPAGQELLGYK PA
1
495-507 (13) ALDPEISSGEGLR PA
1
511-528 (18) LGDEDNWFEINQHTGDLR PA
1
542-557 (16) NNQYNISVVAVDAVGR PA
1
558-579 (22) SCTGTLVVHLDDYNDHAPQIDK PA
1
580-617 (38) EVTICQNNEDFAVLKPVDPDGPENGPPFQFFLDNSASK PA
1
635-649 (15) QNLDYNYYSVPIQIK PA
1
652-663 (12) HGLVATHMLTVR PA
1
664-674 (11) VCDCSTPSECR PA
1
682-691 (10) DVRPNVILGR PA
1
692-717 (26) WAILAMVLGSVLLLCILFTCFCVTAK PA
1
723-751 (29) CFPEDIAQQNLIVSNTEGPGEEVTEANIR PA
1
752-775 (24) LPMQTSNICDTSMSVGTVGGQGIK PA
1
776-784 (9) TQQSFEMVK PA
1
785-793 (9) GGYTLDSNK PA
1
794-804 (11) GGGHQTLESVK PA
1
805-813 (9) GVGQGDTGR PA
1
814-826 (13) YAYTDWQSFTQPR PA
1
831-841 (11) VYLCGQDEEHK PA
0
842-855 (14) HCEDYVCSYNYEGK PA
0
856-868 (13) GSLAGSVGCCSDR PA
0
869-883 (15) QEEEGLEFLDHLEPK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center