Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q0VAA2-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-11 (11) MGVVPVSYFIR PA
0
12-28 (17) NMEESYVNLNHHGLGPR PA
1
32-45 (14) AIAIALVSNMAVTK PA
1
46-87 (42) LELEDNCIMEEGVLSLVEMLQENYYLQEMNISNNHLGLEGAR PA
1
88-95 (8) IISDFFER PA
1
96-111 (16) NSSSIWSLELSGNDFK PA
1
112-129 (18) EDSAALLCQALSTNYQIK PA
1
131-169 (39) LDLSHNQFSDVGGEHLGQMLAINVGLTSLDLSWNNFHTR PA
1
170-179 (10) GAVALCNGLR PA
1
182-202 (21) SSDSTAAWSTWISVAMTSAMK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center