Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q12800-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
7-50 (44) LPLADEVIESGLVQDFDASLSGIGQELGAGAYSMSDVLALPIFK PA
3
51-63 (13) QEESSLPPDNENK PA
3
64-80 (17) ILPFQYVLCAATSPAVK PA
3
81-98 (18) LHDETLTYLNQGQSYEIR PA
5
105-114 (10) LGELPEINGK PA
3
129-141 (13) LQYTEHQQLEGWR PA
4
149-164 (16) ILDIDIPMSVGIIDPR PA
3
165-181 (17) ANPTQLNTVEFLWDPAK PA
3
183-190 (8) TSVFIQPK PA
1
214-288 (75) YQPSYETTILTECSPWPEITYVNNSPSPGFNSSHSSFSLGEGNGSPNHQPEPPPPVTDNLLPTTTPQEAQQWLHR PA
3
297-308 (12) LFTNFSGADLLK PA
3
312-325 (14) DDVIQICGPADGIR PA
3
339-351 (13) LTIYVCQESLQLR PA
3
352-363 (12) EQQQQQQQQQQK PA
5
364-392 (29) HEDGDSNGTFFVYHAIYLEELTAVELTEK PA
3
393-409 (17) IAQLFSISPCQISQIYK PA
3
410-439 (30) QGPTGIHVLISDEMIQNFQEEACFILDTMK PA
3
440-450 (11) ETNDSYHIILK PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center