Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q12815-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
14-21 (8) GVSPTPSK PA
2
30-48 (19) TPFPTVTSCAVDQENQDPR PA
2
50-71 (22) WVQKPPLNIQRPLVDSAGPRPK PA
2
74-81 (8) HQAETSQR PA
2
82-89 (8) LVGISQPR PA
2
90-100 (11) NPLEELRPSPR PA
2
101-137 (37) GQNVGPGPPAQTEAPGTIEFVADPAALATILSGEGVK PA
0
155-163 (9) GSQGGTTQR PA
0
169-176 (8) ASAYLAPR PA
0
208-231 (24) LQALISPSGPSFHPSTRPSFQELR PA
0
240-262 (23) TSVSQASGLLLETPVQPAFSLPK PA
0
266-284 (19) EVVTHSDEGGVASLGLAQR PA
0
298-328 (31) DSHDSHLMPSPAPVAQPLPGHVVPCPSPFGR PA
0
332-347 (16) VPSPGPPTLTSYSVLR PA
0
357-365 (9) FTPMPSTPR PA
0
366-373 (8) VQQAQWLR PA
0
374-394 (21) GVSPQSCSEDPALPWEQVAVR PA
0
395-403 (9) LFDQESCIR PA
0
404-423 (20) SLEGSGKPPVATPSGPHSNR PA
0
424-431 (8) TPSLQEVK PA
0
435-443 (9) IGILQQLLR PA
0
444-477 (34) QEVEGLVGGQCVPLNGGSSLDMVELQPLLTEISR PA
0
478-496 (19) TLNATEHNSGTSHLPGLLK PA
0
497-528 (32) HSGLPKPCLPEECGEPQPCPPAEPGPPEAFCR PA
0
529-561 (33) SEPEIPEPSLQEQLEVPEPYPPAEPRPLESCCR PA
0
562-571 (10) SEPEIPESSR PA
0
572-594 (23) QEQLEVPEPCPPAEPRPLESYCR PA
0
595-604 (10) IEPEIPESSR PA
0
605-638 (34) QEQLEVPEPCPPAEPGPLQPSTQGQSGPPGPCPR PA
0
639-652 (14) VELGASEPCTLEHR PA
0
653-707 (55) SLESSLPPCCSQWAPATTSLIFSSQHPLCASPPICSLQSLRPPAGQAGLSNLAPR PA
0
717-729 (13) SCLTAIHCFHEAR PA
0
730-740 (11) LDDECAFYTSR PA
0
741-748 (8) APPSGPTR PA
0
749-778 (30) VCTNPVATLLEWQDALCFIPVGSAAPQGSP PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center