Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q12846-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
10-20 (11) QGDDSSDEEDK PA
0
23-33 (11) VALVVHPGTAR PA
0
34-44 (11) LGSPDEEFFHK PA
0
65-80 (16) QQVTILATPLPEESMK PA
1
109-121 (13) EEADENYNSVNTR PA
1
125-140 (16) TQHGVLSQQFVELINK PA
1
141-149 (9) CNSMQSEYR PA
1
162-191 (30) ITNAGMVSDEELEQMLDSGQSEVFVSNILK PA
1
198-206 (9) QALNEISAR PA
1
207-215 (9) HSEIQQLER PA
1
219-240 (22) ELHDIFTFLATEVEMQGEMINR PA
1
244-254 (11) NILSSADYVER PA
1
274-297 (24) VLIAICVSITVVLLAVIIGVTVVG PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center