Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q12846-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
31-44 (14) SSSTSPLGHPPQVR PA
0
63-78 (16) QQVTILATPLPEESMK PA
1
107-119 (13) EEADENYNSVNTR PA
1
123-138 (16) TQHGVLSQQFVELINK PA
1
139-147 (9) CNSMQSEYR PA
1
160-189 (30) ITNAGMVSDEELEQMLDSGQSEVFVSNILK PA
1
196-204 (9) QALNEISAR PA
1
205-213 (9) HSEIQQLER PA
1
217-238 (22) ELHDIFTFLATEVEMQGEMINR PA
1
242-252 (11) NILSSADYVER PA
1
272-295 (24) VLIAICVSITVVLLAVIIGVTVVG PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center