Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q12933-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-21 (21) MAAASVTPPGSLELLQPGFSK PA
3
43-52 (10) RPFQAQCGHR PA
3
53-97 (45) YCSFCLASILSSGPQNCAACVHEGIYEEGISILESSSAFPDNAAR PA
2
99-115 (17) EVESLPAVCPSDGCTWK PA
3
125-142 (18) MPACGMVTEAPAVGSRPR PA
0
143-174 (32) SPSSYDLVLHVPLTGAEACLMSVEEETELLLR PA
0
181-192 (12) CPLMLTECPACK PA
3
203-211 (9) HLEHECPER PA
3
220-228 (9) APCCGADVK PA
3
229-236 (8) AHHEVCPK PA
2
237-246 (10) FPLTCDGCGK PA
2
270-283 (14) FHAIGCLETVEGEK PA
3
284-293 (10) QQEHEVQWLR PA
3
294-323 (30) EHLAMLLSSVLEAKPLLGDQSHAGSELLQR PA
3
331-343 (13) TATFENIVCVLNR PA
3
348-357 (10) VAMTAEACSR PA
3
384-393 (10) DLAMADLEQK PA
3
394-409 (16) VLEMEASTYDGVFIWK PA
3
425-437 (13) IPAIFSPAFYTSR PA
3
446-455 (10) IYLNGDGTGR PA
3
456-467 (12) GTHLSLFFVVMK PA
3
468-475 (8) GPNDALLR PA
3
482-492 (11) VTLMLLDQNNR PA
3
493-529 (37) EHVIDAFRPDVTSSSFQRPVNDMNIASGCPLFCPVSK PA
3
546-553 (8) AIVDLTGL PA
3
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center