Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q12933-3)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-21 (21) MAAASVTPPGSLELLQPGFSK PA
3
43-52 (10) RPFQAQCGHR PA
3
53-86 (34) SGPQNCAACVHEGIYEEGISILESSSAFPDNAAR PA
0
88-104 (17) EVESLPAVCPSDGCTWK PA
3
109-117 (9) EYESCHEGR PA
2
118-129 (12) CPLMLTECPACK PA
3
140-148 (9) HLEHECPER PA
3
157-165 (9) APCCGADVK PA
3
166-173 (8) AHHEVCPK PA
2
174-183 (10) FPLTCDGCGK PA
2
207-220 (14) FHAIGCLETVEGEK PA
3
221-230 (10) QQEHEVQWLR PA
3
231-260 (30) EHLAMLLSSVLEAKPLLGDQSHAGSELLQR PA
3
268-280 (13) TATFENIVCVLNR PA
3
285-294 (10) VAMTAEACSR PA
3
321-330 (10) DLAMADLEQK PA
3
331-346 (16) VLEMEASTYDGVFIWK PA
3
362-374 (13) IPAIFSPAFYTSR PA
3
383-392 (10) IYLNGDGTGR PA
3
393-404 (12) GTHLSLFFVVMK PA
3
405-412 (8) GPNDALLR PA
3
419-429 (11) VTLMLLDQNNR PA
3
430-466 (37) EHVIDAFRPDVTSSSFQRPVNDMNIASGCPLFCPVSK PA
3
483-490 (8) AIVDLTGL PA
3
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center