Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q12933-4)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-21 (21) MAAASVTPPGSLELLQPGFSK PA
3
43-52 (10) RPFQAQCGHR PA
3
53-97 (45) YCSFCLASILSSGPQNCAACVHEGIYEEGISILESSSAFPDNAAR PA
2
99-115 (17) EVESLPAVCPSDGCTWK PA
3
120-128 (9) EYESCHEGR PA
2
129-140 (12) CPLMLTECPACK PA
3
151-159 (9) HLEHECPER PA
3
168-176 (9) APCCGADVK PA
3
193-206 (14) FHAIGCLETVEGEK PA
3
207-216 (10) QQEHEVQWLR PA
3
217-246 (30) EHLAMLLSSVLEAKPLLGDQSHAGSELLQR PA
3
254-266 (13) TATFENIVCVLNR PA
3
271-280 (10) VAMTAEACSR PA
3
307-316 (10) DLAMADLEQK PA
3
317-332 (16) VLEMEASTYDGVFIWK PA
3
348-360 (13) IPAIFSPAFYTSR PA
3
369-378 (10) IYLNGDGTGR PA
3
379-390 (12) GTHLSLFFVVMK PA
3
391-398 (8) GPNDALLR PA
3
405-415 (11) VTLMLLDQNNR PA
3
416-452 (37) EHVIDAFRPDVTSSSFQRPVNDMNIASGCPLFCPVSK PA
3
469-476 (8) AIVDLTGL PA
3
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center