Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q13064-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-24 (24) MEEPAAPSEAHEAAGAQAGAEAAR PA
0
25-53 (29) EGVSGPDLPVCEPSGESAAPDSALPHAAR PA
0
54-68 (15) GWAPFPVAPVPAHLR PA
0
70-90 (21) GGLRPAPASGGGAWPSPLPSR PA
0
103-110 (8) YYIHGQCK PA
0
117-124 (8) YSHDLSGR PA
0
126-177 (52) MATEGGVSPPGASAGGGPSTAAHIEPPTQEVAEAPPAASSLSLPVIGSAAER PA
0
190-213 (24) GAAGGAGVESWADAIEFVPGQPYR PA
0
216-232 (17) WVASAPEAPLQSSETER PA
0
234-242 (9) QMAVGSGLR PA
0
255-282 (28) GESCMYLHGDICDMCGLQTLHPMDAAQR PA
0
288-295 (8) ACIEAHEK PA
0
296-305 (10) DMELSFAVQR PA
4
310-321 (12) VCGICMEVVYEK PA
0
329-342 (14) FGILSNCNHSFCIR PA
0
366-384 (19) VTSELVIPSEFWVEEEEEK PA
0
408-419 (12) GNCPFGDTCFYK PA
0
420-450 (31) HEYPEGWGDEPPGPGGGSFSAYWHQLVEPVR PA
0
451-459 (9) MGEGNMLYK PA
0
483-507 (25) DELPFSEDQWDLLHYELEEYFNLIL PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center