Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q13131-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
24-40 (17) IGHYILGDTLGVGTFGK PA
1
90-118 (29) LYQVISTPSDIFMVMEYVSGGELFDYICK PA
1
130-143 (14) LFQQILSGVDYCHR PA
1
150-165 (16) DLKPENVLLDAHMNAK PA
2
166-182 (17) IADFGLSNMMSDGEFLR PA
2
183-199 (17) TSCGSPNYAAPEVISGR PA
2
200-235 (36) LYAGPEVDIWSSGVILYALLCGTLPFDDDHVPTLFK PA
1
237-257 (21) ICDGIFYTPQYLNPSVISLLK PA
1
258-266 (9) HMLQVDPMK PA
1
286-305 (20) YLFPEDPSYSSTMIDDEALK PA
1
311-325 (15) FECSEEEVLSCLYNR PA
1
326-342 (17) NHQDPLAVAYHLIIDNR PA
1
350-374 (25) DFYLATSPPDSFLDDHHLTRPHPER PA
1
375-384 (10) VPFLVAETPR PA
1
387-396 (10) HTLDELNPQK PA
1
413-426 (14) SQSRPNDIMAEVCR PA
1
437-444 (8) VVNPYYLR PA
1
449-457 (9) NPVTSTYSK PA
1
458-468 (11) MSLQLYQVDSR PA
1
476-485 (10) SIDDEITEAK PA
1
486-493 (8) SGTATPQR PA
1
494-501 (8) SGSVSNYR PA
1
506-515 (10) SDSDAEAQGK PA
1
516-555 (40) SSEVSLTSSVTSLDSSPVDLTPRPGSHTIEFFEMCANLIK PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center