Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q13131-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
24-40 (17) IGHYILGDTLGVGTFGK PA
1
90-118 (29) LYQVISTPSDIFMVMEYVSGGELFDYICK PA
1
123-130 (8) SDVPGVVK PA
0
145-158 (14) LFQQILSGVDYCHR PA
1
165-180 (16) DLKPENVLLDAHMNAK PA
2
181-197 (17) IADFGLSNMMSDGEFLR PA
2
198-214 (17) TSCGSPNYAAPEVISGR PA
2
215-250 (36) LYAGPEVDIWSSGVILYALLCGTLPFDDDHVPTLFK PA
1
252-272 (21) ICDGIFYTPQYLNPSVISLLK PA
1
273-281 (9) HMLQVDPMK PA
1
301-320 (20) YLFPEDPSYSSTMIDDEALK PA
1
326-340 (15) FECSEEEVLSCLYNR PA
1
341-357 (17) NHQDPLAVAYHLIIDNR PA
1
365-389 (25) DFYLATSPPDSFLDDHHLTRPHPER PA
1
390-399 (10) VPFLVAETPR PA
1
402-411 (10) HTLDELNPQK PA
1
428-441 (14) SQSRPNDIMAEVCR PA
1
452-459 (8) VVNPYYLR PA
1
464-472 (9) NPVTSTYSK PA
1
473-483 (11) MSLQLYQVDSR PA
1
491-500 (10) SIDDEITEAK PA
1
501-508 (8) SGTATPQR PA
1
509-516 (8) SGSVSNYR PA
1
521-530 (10) SDSDAEAQGK PA
1
531-570 (40) SSEVSLTSSVTSLDSSPVDLTPRPGSHTIEFFEMCANLIK PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center